ⓘ Free online encyclopedia. Did you know? page 251

Landau-Kleffners syndrom

Landau-Kleffner syndrom i blant kalt epilepsi med akvirert afasi er en sykdom hvor barn som til å begynne med utvikler seg normalt, med normal språkutvikling etterhvert mister språk og interessen for lyd rundt seg, ofte i kombinasjon med epilepti ...

Lennox-Gastaut syndrom

Lennox-Gastaut syndrom er en alvorlig form for epilepsi. Anfall begynner vanligvis før 4-årsalderen. Anfalls typer varierer med toniske anfall, atoniske anfall, atypisk fravær, og myoklone anfall. Det kan være perioder med hyppige anfall blandet ...

Meningeom

Meningeomer, eller hjernehinnesvulster, er saktevoksende, oftest godartede svulster utgående fra araknoidale celler i spindelvevshinnen. Meningeom er den hyppigst forekommende primære hjernesvulsten, og utgjør omtrent 36% av alle slike. Livstidsr ...

Migrene

Migrene er en nevrologisk kronisk anfallssykdom med ensidig, pulserende hodepine som varer i cirka 4–72 timer ubehandlet. Lidelsen klassifiseres, i henhold til Headache Classification Committee of the International Headache Societys internasjonal ...

Migrene med aura

Migrene med aura kalles også klassisk migrene og er en hodepinelidelse som ligner migrene uten aura, men i tillegg til de tre fasene den har, så har migrene med aura også har en fjerde fase, kalt aura.

Migrene uten aura

Migrene uten aura eller vanlig migrene er den mest vanlige av to hovedformer av migrene. Den andre er migrene med aura. Alle andre former for migrene klassifiseres som typer og varianter under én av disse to hovedformene. Migrene uten aura er en ...

Motonevronsykdom

Motonevronsykdommer er en gruppe progredierende nevrologiske sykdommer, som leder til ødeleggelse av motonevroner; de nevroner som kontrollerer viljestyrte bevegelser som tale, gange, åndedrett og svelgfunksjon. Amyotrofisk lateralsklerose er den ...

Myelopati

Myelopati er en sykdom eller en skade i ryggmargen. Eksempelvis kan langvarig mangel på Kobalamin medføre degenerasjon av bakstrengene, dorsalhornene. Betegnelsen brukes videre for en rekke tilstander der ryggmargen er påvirket slik at det gir sy ...

Nerveblokk

Nerveblokk eller nerveblokade er en type smertebehandling som brukes til å stille smerter i bestemte organer eller regioner i kroppen. Hensikten er midlertidig å blokkere nervesignaler som utløser smertesignalene. Perifere nerveblokader er nerveb ...

Nevralgi

Nevralgi er nervesmerte som opptrer spontant eller anfallsvis i et begrenset område, som gjerne forsynes av en bestemt nerve eller nervestamme. Nevralgi er ikke en sykdom i seg selv, men et symptom på en sykdom som forårsaker irritasjon og smerte ...

Nevrodegenerative jernavleiringssykdommer

Nevrodegenerative jernavleiringssykdommer er en fellesbetegnelse for flere sjeldne, arvelige sykdommer med overlappende symptomer og funn. Sykdommene har til felles at det avleires jern i hjernen og dette synes å være forårsaket av komplekse og s ...

Pantotenate kinase-assosiert nevrodegenerativ sykdom

Pantotenat kinase-assosiert nevrodegenerasjon, tidligere kalt Hallervorden-Spatz syndrom, er den hyppigste formen for jernavleiringssykdommer i hjernen. Tilstanden er sjelden og skyldes en genetisk mutasjon som arves autosomalt recessivt. Utbrede ...

Parkinsons sykdom

Parkinsons sykdom eller parkinsonisme er en nevrodegenerativ sykdom som rammer substantia nigra. Sykdommen ble først oppdaget og dens symptomer dokumentert i 1817 av den britiske legen James Parkinson; de biokjemiske forandringer i hjernen hos de ...

Paroksysmal hemikrani

Paroksysmal hemikrani er en alvorlig og meget sjelden hodepinelidelse i gruppen av trigeminal-autonome hodepiner, ifølge International Classification of Headache Disorders versjon 3. Dette er en lidelse som karakteriseres av voldsomme ensidige sm ...

Periodisk hypokalemisk paralyse

Periodisk hypokalemisk paralyse er en sjelden genetisk sykdom som karakteriseres av at mengden kalium i blodet synker. Personer med denne mutasjonen får oftest anfall fra og med ungdomstiden, og disse anfallene blir typisk utløst av måltider med ...

Pilocytisk astrocytom

Pilocytisk astrocytom er en hjernesvulst som opptrer hovedsakelig hos barn, og som involverer strukturer i midlinjen, basalt og i bakre skallegrop. Den er allment oppfattet å være en godartet svulst. Pilocytiske astrocytomer er ofte cystiske, og ...

Polynevropati

Polynevropati er en sykdom i nervesystemet som arter seg ved sykdomsmanifestasjoner i flere perifere nerver, hvor det kan være en rekke ikke-traumatiske årsaker, blant dem autoimmune sykdommer, genetiske sykdommer, forgiftninger, metabolske sykdo ...

Postherpetisk nevralgi

Postherpetisk nevralgi er en vedvarende nevropatisk smerte som kan oppstå etter helvetesild. I de fleste tilfeller går helvetesild over av seg selv, i løpet av noen uker, men hos noen kan smertene vedvare i måneder og, i sjeldne tilfeller, mange ...

Ptose

Ptose er en lidelse der et organ får nedsynkning. Begrepet blir som oftest benyttet om lidelsen blefaroptosis, der ett eller begge øvre øyelokk som følge av tilstanden henger ned over og dekker deler av øynene. Denne tilstanden skyldes en affeksj ...

Refsums sykdom

Refsums sykdom, også kalt heredopathia atactica polyneuritiformis, er en sykdom som påvirker metabolismen av fytansyre. Sykdommen er oppkalt etter den norske legen Sigvald Bernhard Refsum). Sykdommen melder seg oftest i sen barnealder eller tidli ...

Schwannomatose

Schwannomatose er en nervesykdom hvor celledelingen går for fort, så cellene som blir til overs dannes som kuler rundt nerver. Disse kulene/svulstene kaller for flere schwannomer eller ett schwannom. Schwannomatose er en sjelden nevrologisk sykdo ...

Surferlammelse

Surferlammelse er en sjelden skade på ryggmargen forårsaket av hyperekstensjon av ryggen som resulterer i lammelse fra livet og ned. Når ryggen er strekt bakover kan det føre til at en blodåre som leder til ryggraden blir akutt innsnevret, som me ...

Tensjonshodepiner

Tensjonshodepiner, også kalt vanlig-, stress- eller spenningshodepine, definert som T6.2.3 i Norsk legemiddelhåndbok, tilhører ifølge International Headache Society og i henhold til ICHD-3 gruppen av trigeminal-autonome hodepiner, og er den vanli ...

Tic

Tic, flertall tics, er en betegnelse for plutselig, ufrivillig, kortvarig sammentrekning av muskler i ansikt eller hals. Disse kalles motoriske tics. Tics kan også ytre seg som lyder i form av kremting, hosting, banning eller gjentagelse av beste ...

Tourettes syndrom

Tourettes syndrom er en arvelig nevrobiologisk lidelse som oppstår i barndommen. Tourettes er preget av ufrivillige bevegelser og minst en ufrivillig lyd, av varierende hyppighet. Tourettes tilhører et spekter av ticsforstyrrelser som også omfatt ...

Tremor

Se også: Tremor band Tremor eller skjelving er ufrivillige, rytmiske muskelbevegelser i én eller flere kroppsdeler hos mennesker og andre jevnvarme dyr. Tremor er en tilstand kan opptre isolert i en muskelgruppe. Tilstanden kan opptre når den akt ...

Trigeminal-autonome hodepiner

Trigeminal-autonome hodepiner eller trigeminal-autonome kefalalgier er, i henhold International Headache Societys gjeldende internasjonale standard for hodepiner – ICHD-3, en gruppe av primære hodepiner, som deler noen unike autonome særtrekk og ...

Trigeminusnevralgier

Trigeminusnevralgi er nevralgi som følge av lesjoner eller sykdom på trigeminusnerven. Sykdommen regnes til ekstrakranielle hodepiner og tilhører gruppen av smertefulle kraniale nevropatier og andre ansiktssmerter, som har tretten undergrupper, h ...

Vegetativ tilstand

Vegetativ tilstand er en tilstand hos en pasient med alvorlig hjerneskade, hvor koma har utviklet seg til en tilstand av våkenhet uten sporbar selvbevissthet. Det er uenighet innen både medisinen og jussen om hvorvidt denne tilstanden er reversib ...

Wernickes encefalopati

Wernickes encefalopati er en ervervet sykdom i sentralnervesystemet, og den oppstår som følge av for lave konsentrasjoner av B-vitaminer og særlig tiamin i kroppen. Tiaminmangel vil også kunne føre til tørr beriberi og Korsakoffs psykose. Dersom ...

X-bundet adrenoleukodystrofi

X-bundet adrenoleukodystrofi er en sjelden, arvelig, metabolsk sykdom som rammer nervesystemet, binyrene og testiklene. Alle som rammes har en mutasjon i ABCD1 -genet på X-kromosomet. Denne genfeilen fører til en opphopning i kroppen av de ultral ...

Askeskuddsyke

Askeskuddsyke er en vindbåren sykdom som rammer treslaget ask. Sykdommen forårsakes av en soppen Chalara fraxinea, og den oppsto i Polen på begynnelsen av 1990-tallet. Den sykdomsbærende soppen er en variant av en harmløs sopp som bryter ned blad ...

Heksekost

Heksekost er et fellesnavn for utvekster på busker som er angrepet av forskjellige sykdommer/sopper, som gir unormal vokst av knopper eller kvister. Det er vanligst på bjørk, der de ofte forekommer som dusker over store deler av kronen. Det forek ...

Meldrøye

Meldrøye eller mjøldrøye er en sopp som vokser på flere grasarter, også kornartene. Den er vanligst på rug, men angriper også hvete og bygg. Meldrøyen har 2–3 cm lange organer, sklerotier, som vokser i kornakset. Sklerotiene inneholder alkaloidet ...

Meldugg

Meldugg, meldogg eller mjøldogg er en plantesykdom forårsaket av sekksporesopper. Det finnes ca. 100 arter som lever på en lang rekke planter slik som trær, gress og urter. Den angriper i særlig grad roser og andre prydvekster. Meldugg utvikler e ...

Potetkreft

Potetkreft er en fryktet potetsykdom som skyldest lavtstående algesopp. Den skader ikke potetplantene direkte, men ødelegger avlingen ved at knollene blir helt eller delvis omdannet til blomkållignende, uspiselige svulster som lett råtner. Sykdom ...

Potettørråte

Potettørråte er sykdom som rammer poteter og tomat. Den skyldes Phytophtora infestans som er en eggsporesopp, en mikroorganisme som tidligere ble regnet som en sopp, men som nå regnes som en art av gulbrune alger som igjen hører til eukaryotene. ...

Pærebrann

Pærebrann er en plantesykdom som angriper epletrær, pæretrær og planter i rosefamilien. Den har vært kjent i USA i over 200 år. Sykdommen forårsaker store skader på verdensbasis, og de siste femti årene har sykdommen vært under spredning i Europa ...

Rirkule

En rirkule eller kåte er en vanligvis halvkuleformet utvekst på stammen av bjerk, gran eller furu, som et resultat av en plantesykdom eller et virusangrep. Veden i disse er oftest hardere enn vanlig treverk, og de er derfor populære for treskjære ...

Snømugg

Snømugg er en betegnelse på muggsopp som angriper gress og korn. Angrep av soppen kan gi flekker eller større flater med dødt gress på eng, golfbaner, fotballbaner og lignende. Snømugg må ikke forveksles med isbrann, som skyldes vekslende mildvær ...

Vannris

Vanris, ofte feilaktig skrevet vannris, enkelte steder også kalt heksekoster, er vanskudd eller knipper med tynne kvister på trestammer. Ordet kommer av sammensetningen "van-" og "ris", altså "feil kvister", og det har ingenting med "vann" å gjør ...

Xylella fastidiosa

Xylella fastidiosa er en gram-negativ bakterie som finnes i vedvevet i visse planter som kan føre til bestemte plantesykdommer. Genomet til X. fastidiosa er sekvensert og det har vært funnet et rundt kromosom på 2 679 305 basepar og to plasmid me ...

Dødelig familiær søvnløshet

Dødelig familiær søvnløshet er en arvelig sjelden søvnlidelse. Færre enn 50 familier i verden er registrert med sykdommen. Lidelsen rammer mennesker i midten av 50-årene, og forårsaker søvnløshet. Etter hvert oppstår hallusinasjoner og paranoia, ...

Skrapesyke

Skrapesyke også kalt Scrapie, er en smittsom, kronisk, nevrologisk sykdom hos sau, geit og muflon. Man tror at sykdommen skyldes prioner og man tror også at den ikke smitter til mennesker.

Psykisk lidelse

Psykiske lidelser eller mentale lidelser er et samlebegrep for forskjellige lidelser og sykdommer som i første rekke rammer sinnet og bevisstheten og ikke den fysiske kroppen. Psykiske lidelser omfatter alt fra plager som enkle fobier og lettere ...

ADHD hos voksne

ADHD hos voksne er det vanlige begrepet som brukes for å beskrive den nevropsykiatriske tilstanden oppmerksomhetssvikt-hyperaktivitetslidelse når den forekommer hos voksne. Opp til 60 % av barn med diagnosen ADHD i tidlig barndom fortsetter å vis ...

Affektavflatning

Affektavflatning er en manglende evne til å reagere med normale følelser i forhold til andre. Det klassifiseres ofte som redusert eller fraværende emosjonell respons. Affektavflatning er en av de symptomene på schizofreni, PTSD og dyssosial perso ...

Affektive lidelser

Affektive lidelser er stemningslidelser som finnes i alle grader, fra lett depresjon som kan være vanskelig å skille fra tristhet, til alvorlige forstemninger med sterke selvmordstanker og vrangforestillinger. Noen kan i perioder være plaget i ul ...

Alice i Eventyrland-syndrom

Alice i Eventyrland-syndrom eller Todd syndrom er en nevrologisk tilstand som påvirker den menneskelige persepsjon, og kan gi hallusinasjoner av å være en ekstremt liten person. Syndromet har navnet etter Lewis Carrols fortelling om Alice i Event ...

Alkoholabstinens

Alkoholabstinens er det sett av symptomer som kan ses når en person reduserer eller kutter ut alkoholforbruk etter lengre perioder med stort alkoholinntak. Overdrevet misbruk av alkohol fører til toleranse og fysisk avhengighet. Abstinens skyldes ...